VEGFA_MOUSE   Q00731


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00731

Recommended name:Vascular endothelial growth factor A

EC number:

Alternative names:(VEGF-A) (Vascular permeability factor) (VPF)

Cleaved into:

GeneID:22339

Gene names  (primary ):Vegfa

Gene names  (synonym ):Vegf

Gene names  (ORF ):

Length:214

Mass:25283

Sequence:MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Tissue specificity:In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

Induction:By IL-6 and FSH in vitro. {ECO:0000269|PubMed:16259067}.

Developmental stage:Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution. {ECO:0000269|PubMed:10878616}.

Protein families:PDGF/VEGF growth factor family


   💬 WhatsApp