FA2H_MOUSE Q5MPP0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5MPP0
Recommended name：Fatty acid 2-hydroxylase
EC number：EC 1.14.18.-
Alternative names：(Fatty acid alpha-hydroxylase)
Cleaved into：
GeneID：338521
Gene names (primary )：Fa2h
Gene names (synonym )：Faah
Gene names (ORF )：
Length：372
Mass：42981
Sequence：MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISADLDGPPHRHSDNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASLTREYSMMMPESVFIGLFVLGMLFWTFVEYVIHRFLFHMKPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEAHPKMQ
Tissue specificity：Expressed in brain (at protein level) (PubMed:16998236). Detected in cerebellum and forebrain (PubMed:18815260, PubMed:15658937). Expression in the white matter is mainly restricted in oligodendrocytes (PubMed:15658937). Expressed in stomach, kidney, skin and testis (PubMed:15658937). Expressed in sebaceous gland (PubMed:21628453). {ECO:0000269|PubMed:15658937, ECO:0000269|PubMed:16998236, ECO:0000269|PubMed:18815260, ECO:0000269|PubMed:21628453}.
Induction：
Developmental stage：Levels increase rapidly in brains from newborns, in parallel with myelination in the central nervous system. Present at very low levels in newborns. Levels are highest at 2 to 3 weeks, and then decrease slightly to reach an constant, intermediate level after 4 months. Constitutively expressed at an intermediate level throughout adult life. {ECO:0000269|PubMed:15658937, ECO:0000269|PubMed:16998236}.
Protein families：Sterol desaturase family, SCS7 subfamily