GHRL_MOUSE Q9EQX0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQX0
Recommended name:Appetite-regulating hormone
EC number:
Alternative names:(Growth hormone secretagogue) (Growth hormone-releasing peptide) (Motilin-related peptide) (Protein M46)
Cleaved into:Ghrelin; Obestatin
GeneID:58991
Gene names (primary ):Ghrl
Gene names (synonym ):Mtlrp
Gene names (ORF ):
Length:117
Mass:13207
Sequence:MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK
Tissue specificity:Mainly expressed in the gastrointestinal tract with higher levels in the stomach, medium levels in the duodenum, jejunum, ileum and colon. Low expression in the testis and brain. Not detected in the salivary gland, pancreas, liver and lung. {ECO:0000269|PubMed:10930375}.
Induction:
Developmental stage:Levels of n-octanoylated and n-decanoylated ghrelin drop by one third and 3-fold, respectively, between postnatal weeks 3 and 4 due to change of diet during weaning. {ECO:0000269|PubMed:15746259}.
Protein families:Motilin family