PR4A1_MOUSE O35256
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35256
Recommended name：Prolactin-4A1
EC number：
Alternative names：(Placental prolactin-like protein A) (PLP-A) (PRL-like protein A)
Cleaved into：
GeneID：19110
Gene names (primary )：Prl4a1
Gene names (synonym )：Prlpa
Gene names (ORF )：
Length：227
Mass：26336
Sequence：MHLSLTPQWSSWTVLLLLVSNLLLWENTASAMRAKRLNVHDYTTFGNTWNQAIQLSQSMNHRISELSTHFKVFYAQGRGFEKRTTRCHTSSLSSPENKEQAQKIQLEVLLGLAHSLLQAWVNPLYHLWAEMCERLGSTPPILSKALEVKTLNRNLLETIEKIAFKGNFEINENGNYTAWSELELLQSPNRDTRYFAFHNLFHCLKKDSSHVEMYLKLLKCRLIQSNC
Tissue specificity：Expressed specifically in placenta. Expressed in both trophoblast giant cells and spongiotrophoblast cells. {ECO:0000269|PubMed:9389542, ECO:0000269|PubMed:9472921}.
Induction：
Developmental stage：Low level on day 8, abundant on days 10 to 14, and decreases by day 16. {ECO:0000269|PubMed:9389542}.
Protein families：Somatotropin/prolactin family