B3GN5_MOUSE   Q8BGY6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGY6

Recommended name:Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase

EC number:EC 2.4.1.206

Alternative names:(Lactotriaosylceramide synthase) (Lc(3)Cer synthase) (Lc3 synthase) (UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5) (BGnT-5) (Beta-1,3-Gn-T5) (Beta-1,3-N-acetylglucosaminyltransferase 5) (Beta3Gn-T5)

Cleaved into:

GeneID:108105

Gene names  (primary ):B3gnt5

Gene names  (synonym ):

Gene names  (ORF ):

Length:376

Mass:43914

Sequence:MRLFVSRRVKRWKIFHFFVTCFILSFMVFWSPINNYIMSHMKSYSYRYLVNSYGFVNNSLSLKHSSVQPHYPYLINHREKCQAQDVLLLLFIKTAPENYGRRSAIRKTWGNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDSFHNLTSKFLLQFSWANTFCPHAKFLMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYEASQTLNSSMYIDDVFMGLCANKVGILPQDHVFFSGEGKIPYHPCIYEKMMTSHGHLQDLQDLWIEATHPKVKNISKGFFGQIYCRLIKIVLLCRLTYRNSYPCWAAFA

Tissue specificity:Highly expressed in adult spleen, placenta and cerebellar Purkinje cells where it colocalized with HNK-1. Expressed at lower level in brain, lung, thymus and muscle. {ECO:0000269|PubMed:11384981}.

Induction:

Developmental stage:Mainly expressed during embryonic development. Expressed in most tissues at embryonic day 11 with elevated expression in the developing central nervous system. {ECO:0000269|PubMed:11384981}.

Protein families:Glycosyltransferase 31 family