SPT33_MOUSE Q8C624
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C624
Recommended name:Spermatogenesis-associated protein 33
EC number:
Alternative names:
Cleaved into:
GeneID:320869
Gene names (primary ):Spata33
Gene names (synonym ):
Gene names (ORF ):
Length:132
Mass:15038
Sequence:MGQSKSKPREKKEEEKSTTTLVTKSKEKVMEKEAKQSDKESQPAESLLFATSKHSRPSSSSEDKPETKQRSSKKRSVIPQIIITRASNETLISYGIPDNDEQRTIREHADWGPYHRHRSPSTIAAYDVHNTE
Tissue specificity:Predominantly expressed in testis (at protein level). {ECO:0000269|PubMed:23844118}.
Induction:
Developmental stage:Mainly expressed in the postpartum and adult testis. Predominantly expressed in the spermatocytes, as well as spermatogonia and round spermatids (at protein level). Expression increases during the first wave of the spermatogenesis. {ECO:0000269|PubMed:23844118}.
Protein families: