HEN2_MOUSE Q64221
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64221
Recommended name：Helix-loop-helix protein 2
EC number：
Alternative names：(HEN-2) (Nescient helix loop helix 2) (NSCL-2)
Cleaved into：
GeneID：18072
Gene names (primary )：Nhlh2
Gene names (synonym )：Hen2
Gene names (ORF )：
Length：135
Mass：15004
Sequence：MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Tissue specificity：In developing neurons.
Induction：
Developmental stage：Markedly restricted pattern of expression predominantly confined to murine embryos at days 11-13 of development, although low level expression can be detected in murine embryos flanking this time point.
Protein families：