FOXA1_MOUSE P35582
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35582
Recommended name：Hepatocyte nuclear factor 3-alpha
EC number：
Alternative names：(HNF-3-alpha) (HNF-3A) (Forkhead box protein A1)
Cleaved into：
GeneID：15375
Gene names (primary )：Foxa1
Gene names (synonym )：Hnf3a Tcf-3a Tcf3a
Gene names (ORF )：
Length：468
Mass：48854
Sequence：MLGTVKMEGHESNDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANTGLGAGLSPGAVAGMPGASAGAMNSMTAAGVTAMGTALSPGGMGSMGAQPATSMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGSGGGGSKGGPESRKDPSGPGNPSAESPLHRGVHGKASQLEGAPAPGPAASPQTLDHSGATATGGASELKSPASSSAPPISSGPGALASVPPSHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGATLPASLPLGSASVATRSPIEPSALEPAYYQGVYSRPVLNTS
Tissue specificity：Restricted mainly to endoderm-derived tissues (lung, liver, stomach, and small intestine). Expressed in the prostate. {ECO:0000269|PubMed:15987773}.
Induction：
Developmental stage：Most abundant in midgestation embryos (day 9.5). In embryonic lung expressed at 12 dpc and 18 dpc with highest levels in proximal airways and lowest levels in the distal lung. {ECO:0000269|PubMed:17220277}.
Protein families：