STAM1_MOUSE   P70297


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70297

Recommended name:Signal transducing adapter molecule 1

EC number:

Alternative names:(STAM-1)

Cleaved into:

GeneID:20844

Gene names  (primary ):Stam

Gene names  (synonym ):Stam1

Gene names  (ORF ):

Length:548

Mass:59771

Sequence:MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSAQMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIYSPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQAYSQKALL

Tissue specificity:Ubiquitously expressed. Enriched expression in synaptic vesicles. {ECO:0000269|PubMed:8780729}.

Induction:

Developmental stage:No change during brain development.

Protein families:STAM family


   💬 WhatsApp