LYZL4_MOUSE Q9D925
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D925
Recommended name：Lysozyme-like protein 4
EC number：
Alternative names：(Lysozyme-4)
Cleaved into：
GeneID：69032
Gene names (primary )：Lyzl4
Gene names (synonym )：Lyc4
Gene names (ORF )：
Length：145
Mass：16198
Sequence：MQLYLVLLLISYLLTPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEDPQDGSTGFGLFQIRDNEWCGHGKNLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPIWSKNCQLSDVLDRWLDGCDL
Tissue specificity：Expressed strongly in testis and in epididymis, and weakly in brain and lung (PubMed:21444326, PubMed:24013621). Detected in sperm (at protein level) (PubMed:21444326). {ECO:0000269|PubMed:21444326, ECO:0000269|PubMed:24013621}.
Induction：
Developmental stage：No expression in the testis of 2-weeks-old neonates, the expression reaches a peak level at 12 weeks. After that, the level gradually decreases as the age increases (PubMed:21444326, PubMed:24013621). {ECO:0000269|PubMed:21444326, ECO:0000269|PubMed:24013621}.
Protein families：Glycosyl hydrolase 22 family