TX261_MOUSE Q62302
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62302
Recommended name：Protein TEX261
EC number：
Alternative names：(Testis-expressed protein 261)
Cleaved into：
GeneID：21766
Gene names (primary )：Tex261
Gene names (synonym )：
Gene names (ORF )：
Length：196
Mass：22524
Sequence：MWFMYVLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Tissue specificity：Detected in testis. {ECO:0000269|PubMed:8703127}.
Induction：
Developmental stage：Not detectable in testis from 6 day old animals. Detectable in testis 15 days after birth. Highly expressed in testis 20 days after birth. Highly expressed in meiotic and post-meiotic germ cells.
Protein families：SVP26 family