SPO11_MOUSE Q9WTK8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTK8
Recommended name：Meiotic recombination protein SPO11
EC number：EC 5.6.2.2
Alternative names：
Cleaved into：
GeneID：26972
Gene names (primary )：Spo11
Gene names (synonym )：
Gene names (ORF )：
Length：396
Mass：44570
Sequence：MAFAPMGPEASFFDALDRHRASLLAMVKRGAGETPAGATRVASSSEVLTAIENIIQDIIKSLARNEVPAFTIDNRSSWENIMFDDSVGLRMIPQCTTRKIRSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDAKFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDTFHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTIPTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPYITYQPLWKKELEMMADSKMKAEIQALTLLSSDYLSRVYLPNKLRFGGWI
Tissue specificity：High levels are found only in the testis where expression is restricted primarily to meiotic germ cells. Not expressed in spermatogonia. Highest levels are found in pachytene spermatocytes. Very low levels are found in thymus, brain and oocytes of embryonic ovary. Not detected in adult ovary (PubMed:10622720, PubMed:10855504). Isoform 1: Expressed early in meiosis, when most double-strand breaks (DSB) are formed (PubMed:21330546). {ECO:0000269|PubMed:10534401, ECO:0000269|PubMed:10622720, ECO:0000269|PubMed:10855504, ECO:0000269|PubMed:21330546}.
Induction：
Developmental stage：Not detected at day 7 postpartum (dpp). Levels are low at 12 dpp but increase by 17 dpp. High levels are maintained throughout the remainder of testis development. {ECO:0000269|PubMed:10622720, ECO:0000269|PubMed:10855504}.
Protein families：TOP6A family