EGFL8_MOUSE   Q6GUQ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6GUQ1

Recommended name:Epidermal growth factor-like protein 8

EC number:

Alternative names:(EGF-like protein 8)

Cleaved into:

GeneID:81701

Gene names  (primary ):Egfl8

Gene names  (synonym ):Ng3

Gene names  (ORF ):

Length:293

Mass:32066

Sequence:MGLWAELCISLRGLSFFLVLMTGEGTRGGSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG

Tissue specificity:Ubiquitously expressed in brain, kidney, thymus and lung. {ECO:0000269|PubMed:15162510}.

Induction:

Developmental stage:Not detected before 11.5 dpc and expression levels vary between 11.5 dpc and 15.5 dpc. {ECO:0000269|PubMed:15162510}.

Protein families:


   💬 WhatsApp