ARF_MOUSE Q64364
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64364
Recommended name：Tumor suppressor ARF
EC number：
Alternative names：(Alternative reading frame) (ARF) (Cyclin-dependent kinase inhibitor 2A) (p19ARF)
Cleaved into：
GeneID：12578
Gene names (primary )：Cdkn2a
Gene names (synonym )：
Gene names (ORF )：
Length：169
Mass：19238
Sequence：MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA
Tissue specificity：
Induction：By progesterone. Induced by activated Ras, and this requires DMTF1. Repressed by non-classical inhibitors of NF-kappa-B signaling such as doxorubicin, daunorubicin and UVC, and by the NF-kappa-B p65 subunit (RELA). {ECO:0000269|PubMed:10898794, ECO:0000269|PubMed:15105443, ECO:0000269|PubMed:15601844, ECO:0000269|PubMed:17546045}.
Developmental stage：Not detected in 12-week virgin mammary glands. Expression increases (at protein level) six-fold during pregnancy and remains at this level during lactation. During involution, a slight increase is observed at days 2 and 8 followed by a sharp decline at day 15. {ECO:0000269|PubMed:15105443}.
Protein families：