ZP1_MOUSE Q62005
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62005
Recommended name：Zona pellucida sperm-binding protein 1
EC number：
Alternative names：(Zona pellucida glycoprotein 1) (Zp-1)
Cleaved into：Processed zona pellucida sperm-binding protein 1
GeneID：22786
Gene names (primary )：Zp1
Gene names (synonym )：
Gene names (ORF )：
Length：623
Mass：68723
Sequence：MAWGCFVVLLLLAAAPLRLGQRLHLEPGFEYSYDCGVRGMQLLVFPRPNQTVQFKVLDEFGNRFEVNNCSICYHWVTSEAQEHTVFSADYKGCHVLEKDGRFHLRVFIQAVLPNGRVDIAQDVTLICPKPDHTVTPDPYLAPPTTPEPFTPHAFALHPIPDHTLAGSGHTGLTTLYPEQSFIHPTPAPPSLGPGPAGSTVPHSQWGTLEPWELTELDSVGTHLPQERCQVASGHIPCMVNGSSKETCQQAGCCYDSTKEEPCYYGNTVTLQCFKSGYFTLVMSQETALTHGVLLDNVHLAYAPNGCPPTQKTSAFVVFHVPLTLCGTAIQVVGEQLIYENQLVSDIDVQKGPQGSITRDSAFRLHVRCIFNASDFLPIQASIFSPQPPAPVTQSGPLRLELRIATDKTFSSYYQGSDYPLVRLLREPVYVEVRLLQRTDPSLVLVLHQCWATPTTSPFEQPQWPILSDGCPFKGDNYRTQVVAADREALPFWSHYQRFTITTFMLLDSSSQNALRGQVYFFCSASACHPLGSDTCSTTCDSGIARRRRSSGHHNITLRALDIVSSPGAVGFEDAAKLEPSGSSRNSSSRMLLLLLAITLALAAGIFVGLIWAWAQKLWEGIRY
Tissue specificity：Expressed in oocytes. {ECO:0000269|PubMed:7635043}.
Induction：
Developmental stage：Not detected in resting oocytes. As oocytes begin to grow, levels increase to reach a maximum in midsized oocytes. Levels decrease in later stages of oocyte growth. {ECO:0000269|PubMed:7635043}.
Protein families：ZP domain family, ZPB subfamily