PTN_MOUSE P63089
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63089
Recommended name:Pleiotrophin
EC number:
Alternative names:(PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neutrophic factor) (HBNF) (Osteoblast-specific factor 1) (OSF-1)
Cleaved into:
GeneID:19242
Gene names (primary ):Ptn
Gene names (synonym ):
Gene names (ORF ):
Length:168
Mass:18869
Sequence:MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Tissue specificity:Osteoblast and brain (PubMed:1701634, PubMed:1768439). Expressed in the follicular epithelium and granulosa cells of the ovary. Strongly expressed in the uterus of newborn mice, and the degree of expression decreased in one-week-old mice, although the expression continues even in the uteri of adult mice. Expression gradually increases from proestrus to estrus, then decreases sharply, and thereafter gradually increased again (PubMed:17121547). strongly expressed in the cochlea of WT mice 1 week after birth, and then the expression decreased and was undetectable by week 8 after birth (PubMed:16619002). Expressed around the cell soma of osteocytes and apparently captured in the unmineralized interstitial matrix surrounding the cells. Furthermore distributed throughout the intraosseous canalicular porosity, being localized in the unmineralized matrix around the cell processes. Strongly expressed in the innermost layer of the periosteum (PubMed:19442624). {ECO:0000269|PubMed:16619002, ECO:0000269|PubMed:1701634, ECO:0000269|PubMed:17121547, ECO:0000269|PubMed:1768439, ECO:0000269|PubMed:19442624}.
Induction:Enhanced up to 3 days after the administration of chorionic gonadotropin to induce ovulation (PubMed:17121547). Up-regulated by progesterone in the uterine stromal cells through cAMP (PubMed:28657144). {ECO:0000269|PubMed:17121547, ECO:0000269|PubMed:28657144}.
Developmental stage:NoT detected in the uteri from days 1-3 of pregnancy. On day 4 of pregnancy, localizes in the luminal and glandular epithelium as well as in the uterine stromal cells. On day 5, a high level is observed in the subluminal stroma surrounding the implanting blastocyst, while there is no expression at the inter-implantation sites. From day 6-8 of pregnancy, strongly expressed in the decidua. Expression is gradually increased as the progression of pregnancy and reached a maximum on day 8. Elevated expression is observed at implantation sites from days 5-8 of pregnancy. {ECO:0000269|PubMed:28657144}.
Protein families:Pleiotrophin family