PR7A2_MOUSE   O54831


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54831

Recommended name:Prolactin-7A2

EC number:

Alternative names:(Placental prolactin-like protein F) (PLP-F) (PRL-like protein F)

Cleaved into:

GeneID:19114

Gene names  (primary ):Prl7a2

Gene names  (synonym ):Prlpf

Gene names  (ORF ):

Length:253

Mass:28921

Sequence:MSFSFSQPCPSGALLLVVVSSLLLWENVASVPLSSNETDGYPLSINGLFHNAMRLTWNIKNLNMELRKTYTVNQVSEKLYENYMLDFIEDMEYLVKALTCCHNYSIKTPENLDEAQQIPFNEFPKLILSRMWAWNETSKVLLTTLRSIPGMHDDVISLAKNIETKLAELFEYTQSILNSIYGTTTTGNVEYTVFSGLEDLKSSDEEFSLFDLCKFSYCLRVDIHMVELYLKLLECVVYVSSDVCLSKNIRDAS

Tissue specificity:Expression restricted to the placental tissue. Expressed only in the spongiotrophoblasts. {ECO:0000269|PubMed:9389541}.

Induction:

Developmental stage:Not detected until later in gestation.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp