TSPO2_MOUSE Q9CRZ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CRZ8
Recommended name：Translocator protein 2
EC number：
Alternative names：(Peripheral-type benzodiazepine receptor-like protein 1)
Cleaved into：
GeneID：70026
Gene names (primary )：Tspo2
Gene names (synonym )：Bzrpl1
Gene names (ORF )：
Length：162
Mass：18286
Sequence：MQLQGPVFVGVPLLGPILICMLIHQPSSRCEDERKLPWCPPHKVILLVWVTIYSVMGYASYLVWKELGGGFRWPLALPLGLYSFQLALSWTFLVLFLAADSPGLALLDLLLLYGLVASLVFIWQPINKLAALLLLPYLAWLTVTTAITYRLWRDSLCPTYQP
Tissue specificity：Expressed in liver, bone marrow and spleen. In spleen, detected in red pulp but not in white pulp. {ECO:0000269|PubMed:19729679}.
Induction：
Developmental stage：Not expressed at 10.5 dpc. First detected at 12.5 dpc in the primordial liver (PubMed:19729679). Increased hepatic levels are found at 15.5 dpc followed by decline throughout newborn stage P1 and postnatal stages P5 and P10 with no hepatic expression in the adult (PubMed:19729679). In bone marrow, expressed during late gestation stages and remains elevated until adulthood (PubMed:19729679). In newborn and adult mice, also expressed in spleen (PubMed:19729679). {ECO:0000269|PubMed:19729679}.
Protein families：TspO/BZRP family