BTBD3_MOUSE   P58545


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P58545

Recommended name:BTB/POZ domain-containing protein 3

EC number:

Alternative names:

Cleaved into:

GeneID:228662

Gene names  (primary ):Btbd3

Gene names  (synonym ):

Gene names  (ORF ):

Length:530

Mass:58802

Sequence:MVDDKEKNMKCLTFFLMLPETVKNRSKKGSKKANSSGGGGGGGSVGSGSSKLPPVCYEIITLKTKKKKKMAADIFPRKKPANSSSTTVQQQHQHNLCNNNLIPAPNWQGLYPTIRERNAVMFNNDLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAKEIVVFEAALNWAEVECQRQDLALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFLWYTASKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSAEYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVVLDGNELSYFGQEGMTEVQCGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA

Tissue specificity:In the somatosensory cortex, specifically expressed in spiny stellate neurons during barrel formation. Also expressed in the olfactory bulb, piriform cortex and hippocampus. {ECO:0000269|PubMed:24179155}.

Induction:

Developmental stage:Not expressed in early postnatal somatosensory cortex at postnatal day 1 (P1): weakly expressed at P2, coincident with innervation by thalamocortical axons into layer IV cortex, followed by a barrel-like expression pattern established over the next few days. {ECO:0000269|PubMed:24179155}.

Protein families:


   💬 WhatsApp