NETO2_MOUSE Q8BNJ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BNJ6
Recommended name：Neuropilin and tolloid-like protein 2
EC number：
Alternative names：(Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2)
Cleaved into：
GeneID：74513
Gene names (primary )：Neto2
Gene names (synonym )：Btcl2
Gene names (ORF )：
Length：525
Mass：59368
Sequence：MALEQLCAVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEIRDGPFGFSPLIDRYCGMKSPALIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLREKEISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALEDRVMEEIPCEIYVRGRDDSAQASISIDF
Tissue specificity：Expressed in brain tissues, including cerebellar granule cells (at protein level). {ECO:0000269|PubMed:15464227, ECO:0000269|PubMed:19217376}.
Induction：
Developmental stage：Observed restrictively in brain throughout embryonic (E) and postnatal stages (P). Expression pattern in brain slightly changes from 13 dpc to P21. {ECO:0000269|PubMed:15464227}.
Protein families：