SFRP4_MOUSE Q9Z1N6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1N6
Recommended name：Secreted frizzled-related sequence protein 4
EC number：
Alternative names：(FRP-4) (sFRP-4)
Cleaved into：
GeneID：20379
Gene names (primary )：Sfrp4
Gene names (synonym )：
Gene names (ORF )：
Length：351
Mass：40342
Sequence：MLRSILVALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS
Tissue specificity：Expressed in the ovary. Localized to granulosa cells of periovulatory follicles and corpora lutea. Weakly expressed in adult tissues including kidney, brain and lung. {ECO:0000269|PubMed:12960062}.
Induction：Induced in ovaries by chorionic gonadotropin (CG). {ECO:0000269|PubMed:12960062}.
Developmental stage：Only weakly expressed in developing embryo except for developing teeth, eye and salivary gland. In the developing eye, from 12.5 dpc, expressed in the future neural retina, in both the inner and outer cell layers. In the developing teeth, strong expression detected in the developing incisor teeth at 14.5 dpc. Expression localized to the mesenchyme of the dental follicle surrounding the enamel organ only at the early cap stage. Highly expressed in the branching epithelium of the salivary gland. {ECO:0000269|PubMed:9739103}.
Protein families：Secreted frizzled-related protein (sFRP) family