HOP2_MOUSE O35047
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35047
Recommended name：Homologous-pairing protein 2 homolog
EC number：
Alternative names：(PSMC3-interacting protein) (Proteasome 26S ATPase subunit 3-interacting protein) (Tat-binding protein 1-interacting protein) (TBP-1-interacting protein)
Cleaved into：
GeneID：19183
Gene names (primary )：Psmc3ip
Gene names (synonym )：Hop2 Tbpip
Gene names (ORF )：
Length：217
Mass：24748
Sequence：MSKSRAEAAAGAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKIYFADQNQFDTVSDADLHGLDASIVALTAKVQSLQQSCRHMEAELKELTSALTTPEMQKEIQELKKECAQYTERLKNIKAATNHVTPEEKEKVYRDRQKYCKEWRKRKRMTTELCDAILEGYPKSKKQFFEEVGIETDEDHNVLLPDP
Tissue specificity：Highly expressed in testis and more specifically in spermatocytes. Detected in spleen, ovary and thymus. {ECO:0000269|PubMed:11739747, ECO:0000269|PubMed:9345291}.
Induction：
Developmental stage：Overexpressed at day 11 in the embryo. {ECO:0000269|PubMed:11739747}.
Protein families：HOP2 family