RBM11_MOUSE Q80YT9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80YT9
Recommended name：Splicing regulator RBM11
EC number：
Alternative names：(RNA-binding motif protein 11)
Cleaved into：
GeneID：224344
Gene names (primary )：Rbm11
Gene names (synonym )：
Gene names (ORF )：
Length：238
Mass：26945
Sequence：MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCAKINSHSFRNDEMAGRPSFPVPFFPITSAALPQEYFFFQKMPWYAHSPVLQPPFCEMPAPLPNSVPGSCALNHSPGPEAGPSSYEWTHQPPSDPDLYPRNKRKRQRPDSDSDSSSEDKRGNEGSQKCRKCKKKKRY
Tissue specificity：Selectively expressed in brain, cerebellum and testis, and to a lower extent in kidney. {ECO:0000269|PubMed:21984414}.
Induction：
Developmental stage：Peaks perinatally in brain and cerebellum, and at puberty in testis, in concomitance with differentiation events occurring in neurons and germ cells. {ECO:0000269|PubMed:21984414}.
Protein families：