PR3B1_MOUSE P09586
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09586
Recommended name：Prolactin-3B1
EC number：
Alternative names：(Chorionic somatomammotropin hormone 2) (Placental lactogen II) (PL-II)
Cleaved into：
GeneID：18776
Gene names (primary )：Prl3b1
Gene names (synonym )：Csh2 Pl-2 Pl2
Gene names (ORF )：
Length：222
Mass：25159
Sequence：MKLSLSQPCSFSGALLLLAVSNLLVWEKVTSLPNYRLPTESLYQRVIVVSHNAHDLASKAFMEFEMKFGRTAWTYGLMLSPCHTAAILTPENSEQVHQTTSEDLLKVSITILQAWEEPLKHMVAAVAALPHVPDTLLSRTKELEERIQGLLEGLKIIFNRVYPGAVASDYTFWSAWSDLQSSDESTKNSALRTLWRCVRRDTHKVDNYLKVLKCRDVHNNNC
Tissue specificity：
Induction：
Developmental stage：Placental lactogen I is expressed in mid-pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy.
Protein families：Somatotropin/prolactin family