ZFAN3_MOUSE   Q497H0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q497H0

Recommended name:AN1-type zinc finger protein 3

EC number:

Alternative names:(Testis-expressed protein 27)

Cleaved into:

GeneID:21769

Gene names  (primary ):Zfand3

Gene names  (synonym ):Tex27

Gene names  (ORF ):

Length:227

Mass:25081

Sequence:MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSVTTPTLSPSQQSLPTELNVTSPSTEECGPCTDTAHVSLITPTKRSCGADSQSENEASPVKRPRLVENPERPEESGRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAIMKMVKLDRKVGRSCQRIGEGCS

Tissue specificity:Expressed in testis. {ECO:0000269|PubMed:8703127}.

Induction:

Developmental stage:Preferentially expressed during the haploid stages of spermatogenesis. {ECO:0000269|PubMed:10366431}.

Protein families:


   💬 WhatsApp