TESP1_MOUSE Q3U132
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3U132
Recommended name：Protein TESPA1
EC number：
Alternative names：(Thymocyte-expressed positive selection-associated protein 1)
Cleaved into：
GeneID：67596
Gene names (primary )：Tespa1
Gene names (synonym )：
Gene names (ORF )：
Length：458
Mass：51768
Sequence：MEASVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDALDPEPSSLDDVFQEGNPINKIEDWLQGCGCRDTEEGLSEESGQSNYSGYSSHGTSFEDDLSLGAEATLLSTNGNLFSRNFLQTPRLCQLLDLGSSLASSSMTGGTNKTSSSISEILDQVQEDAEDILFSLGFGHENHKDTSRIPARFFSNPSQAKGINFQLFLKSQVQRMEMEDPCLMLASRFKQVQTLAVTADAFFCLYSYVSKTPVQKFTPSNMFWNFDPTDVPSIRILAPEPEPYSPRERLRRAISKMCLYTGSRDRLSSSYNNPKKNSLDQIVWEVMDRVKGEKIQQDPEHRQALGEESVPPIQNTNPSTSSLPCVSYPKEETQGDMCHAHALARPGPQYHINSTQVRRQLWVLQDINEKPRSAENESPWERKSKARKNLFQRVPVDKNIKSLNLPTIQQKQNQGQARHELTNL
Tissue specificity：Expressed in lymphoid tissues, with highest expression levels detected in thymus and lower levels in spleen and lymph nodes (at protein level). Detected in CD4(+) and CD8(+) T-cells, B-cells and mast cells. Not detected in monocytes/macrophages. {ECO:0000269|PubMed:22561606, ECO:0000269|PubMed:23650607}.
Induction：
Developmental stage：Present in fetal thymus at 14.5 dpc. Expressed during thymocyte maturation, the expression being highest in CD4(+)CD8(+) thymocytes and decreasing with maturation. {ECO:0000269|PubMed:22561606}.
Protein families：