TMIE_MOUSE   Q8K467


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K467

Recommended name:Transmembrane inner ear expressed protein

EC number:

Alternative names:

Cleaved into:

GeneID:20776

Gene names  (primary ):Tmie

Gene names  (synonym ):

Gene names  (ORF ):

Length:153

Mass:17027

Sequence:MAGRQHGSGRLWALGGAALGACLAGVATQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSIIITLCCVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEIPGEDKKKKKKDSVDTVAIKVEEDEKNEAKKKGEK

Tissue specificity:Expressed in brain, kidney, liver, lung and cochlea. {ECO:0000269|PubMed:12140191}.

Induction:

Developmental stage:Required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles.

Protein families:


   💬 WhatsApp