EVX1_MOUSE P23683
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23683
Recommended name：Homeobox even-skipped homolog protein 1
EC number：
Alternative names：(EVX-1)
Cleaved into：
GeneID：14028
Gene names (primary )：Evx1
Gene names (synonym )：
Gene names (ORF )：
Length：416
Mass：43198
Sequence：MESRKDMVMFLDGGQLGTLVGKRVSNLSEAVSSPLPEPPEKMVPHGCLSPRAGPPTSRERGGGGQEEEPVDGLAGSAAGLGAEPRSAGAAMLGPGPPVPSADSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKAPGSDALGSSPTSGSEAPKSNGGSGGSGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGPLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAAAAAAAGPCSCLACHSGPANGLAPRAAAAAAASDFTCASTSRSDSFLTFAPSVLSKASSVAALDQREEVPLTR
Tissue specificity：
Induction：
Developmental stage：Shows a graded distribution in the primitive streak and in cells lateral to it. It is not detected in cells along the A-P axis of the embryo anterior to the primitive streak, except at 7.5 dpc when there is transient expression in the head process. The highest levels of expression are found within the proximal (posterior) portion of the primitive streak and cells near it, with expression levels decreasing more distally (anteriorly).
Protein families：Even-skipped homeobox family