LHX6_MOUSE Q9R1R0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1R0
Recommended name:LIM/homeobox protein Lhx6
EC number:
Alternative names:(LIM homeobox protein 6) (LIM/homeobox protein Lhx6.1)
Cleaved into:
GeneID:16874
Gene names (primary ):Lhx6
Gene names (synonym ):Lhx6.1
Gene names (ORF ):
Length:363
Mass:40044
Sequence:MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGRASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIYCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPTRLPSALSDDIHYSPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADLDGPLSSRGEKVILFQY
Tissue specificity:Brain specific. Expressed by neurons in the amygdala that are activated by reproductive olfactory stimuli and project in regions of the hypothalamus involved in reproduction (at protein level). {ECO:0000269|PubMed:10393337, ECO:0000269|PubMed:15944132}.
Induction:
Developmental stage:Specifically expressed during brain maturation from 14.5 dpc to P2 by a subset of tangentially migrating interneurons. Barely detectable in adult brain. Isoform 1 expression peaks at P2 and remains high in adulthood compared to isoform 2. Expressed in preoptic area, hypothalamic regions and the first branchial arch at 9.5 dpc. Expressed uniformly in the odontogenic mesenchyme of the first branchial arch prior to initiation of tooth development. During odontogenesis expression is restricted to the mesenchyme participating in the formation of individual teeth. Expressed in olfactory bulb, arcuate nucleus, medial glanglionic eminence and preoptic area at 13.5 dpc and 14.5 dpc. Expression spread to the cortex and hippocampus at P1.0. Preferentially expressed in parvalbumin or somatostatin positive cortical interneurons. {ECO:0000269|PubMed:10479690, ECO:0000269|PubMed:17376969, ECO:0000269|PubMed:18613121, ECO:0000269|PubMed:9570771}.
Protein families: