MSGN1_MOUSE Q9JK54
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK54
Recommended name：Mesogenin-1
EC number：
Alternative names：(Paraxial mesoderm-specific mesogenin1) (pMesogenin1) (pMsgn1)
Cleaved into：
GeneID：56184
Gene names (primary )：Msgn1
Gene names (synonym )：
Gene names (ORF )：
Length：188
Mass：20553
Sequence：MDNLGETFLSLEDGLDSSDTAGLLASWDWKSRARPLELVQESPTQSLSPAPSLESYSEVALPCGHSGASTGGSDGYGSHEAAGLVELDYSMLAFQPPYLHTAGGLKGQKGSKVKMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSSGREPRPQSV
Tissue specificity：
Induction：
Developmental stage：Specifically expressed in unsegmented paraxial mesoderm and its immediate progenitors and sharply down-regulated in presumptive somites. Not detectable at 6.5 dpc. At 7.5 dpc, expressed mainly in the posterior region of the embryo, lateral to the primitive streak where presumptive progenitors of paraxial mesoderm reside. Expression is largely excluded from the midline of the primitive streak. No expression is detected in the anterior part of the embryo. At 9.0 dpc, highly expressed in the caudal presomitic mesoderm. At 11.5 dpc, the primitive streak completely regresses, expression is observed exclusively in the tailbud. Expression remains in the tailbud until 13.5 dpc and begins to disappear between 13.5 and 14.5 dpc when the tailbud loses its potential to provide paraxial mesoderm cells. {ECO:0000269|PubMed:10837126}.
Protein families：