CC115_MOUSE Q8VE99
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VE99
Recommended name：Coiled-coil domain-containing protein 115
EC number：
Alternative names：(Coiled-coil protein 1) (Ccp1)
Cleaved into：
GeneID：69668
Gene names (primary )：Ccdc115
Gene names (synonym )：
Gene names (ORF )：
Length：180
Mass：19743
Sequence：MAVQALREELDSKCLQLLSDLEELEAKRAALNARVEEGWLSLAKARYAMGAKSVGPLQYASRMEPQVCVRASEAQDGPQTFRVIKADAQTPEEVGPSEASLRRRKGPTKTKELGSAVVPQDPLNWFGILVPHSLRQAQASFRDGLQLAADIASLQTRINWGQSQLRGLQKKLKELDPGPA
Tissue specificity：Predominantly expressed in the heart, liver, kidney and testis and at lower levels in the brain and lung. Undetectable in the spleen and muscles. {ECO:0000269|PubMed:16378758}.
Induction：Modestly up-regulated by FGF2. {ECO:0000269|PubMed:16378758}.
Developmental stage：Strongly expressed at 13.5 dpc in a ventro-lateral area of striatum and piriform cortex. At 14.5 dpc, some of the positive cells shift toward the cortical plate. At this stage, strongly observed at the superficial layer of dorsal cortex, whereas that of ventral cortex decreases in its intensity. Expression extended further dorsally at 16.5 dpc. In the dorsal cortex, expressed in the ventricular zone at 13.5 dpc. At later stages, expression shifts to the cortical plate. At 15.5 dpc, localizes to both ventricular zone and cortical plate. At 16.5 dpc, almost all expression is in the deeper cortical plate, although some expressing cells are still detectable in the ventricular zone. In the lateral cortex, weak expression in the lateral ganglionic eminence at 13.5 dpc. At 15.5 dpc, strongly detected in the progenitor zones of the lateral ganglionic eminence and medial ganglionic eminence, as well as in tangentially migrating cells in the superficial area of lateral cortex. In the striatum and ventro-lateral cortex, expressed at both 13.5 dpc and 15.5 dpc. {ECO:0000269|PubMed:16378758}.
Protein families：