PLAC1_MOUSE   Q9JI83


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JI83

Recommended name:Placenta-specific protein 1

EC number:

Alternative names:(EPCS26)

Cleaved into:

GeneID:56096

Gene names  (primary ):Plac1

Gene names  (synonym ):

Gene names  (ORF ):

Length:173

Mass:19626

Sequence:MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLNNDVYVHFYEVHLGLGCPPNHVHPHFYQFHYRVTECGIRIKAVSPDVVIYSSEIHYASKGSSTKYVIPVSCAAPRRSPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSCPPYVYNQKSM

Tissue specificity:Expressed in placenta. {ECO:0000269|PubMed:10995572}.

Induction:

Developmental stage:Strongly expressed at 7 dpc and gradually declines with the progression of embryogenesis. Expression detected from 7.5 to 14.5 dpc in ectoplacental cone, trophoblast giant cells, and labyrinthine trophoblasts. {ECO:0000269|PubMed:10995572}.

Protein families:PLAC1 family


   💬 WhatsApp