DCP2_MOUSE Q9CYC6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CYC6
Recommended name：m7GpppN-mRNA hydrolase
EC number：EC 3.6.1.62
Alternative names：(mRNA-decapping enzyme 2)
Cleaved into：
GeneID：70640
Gene names (primary )：Dcp2
Gene names (synonym )：
Gene names (ORF )：
Length：422
Mass：48380
Sequence：MEPKRLEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAGSTPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPLQQKSHSNHGEVSDLLKAKNQNMRGNGRKQYQDSPNQKKRANGVHGQPAKQQNPLVKCEKKLHPRKLQDNFETDATCDLPCSGEEPSVEHAEGHSVACNGHCKFPFSSRAFLSFKFDQNAIMKILDL
Tissue specificity：Strongly expressed in brain and testis. Weakly expressed in lung. Not detected in heart, liver, kidney and muscle (at protein level). {ECO:0000269|PubMed:21070968}.
Induction：
Developmental stage：Strongly expressed in brain, heart, liver at 14.5 and 16.5 dpc. Strongly expressed in brain at 20 dpc. Weakly expressed in heart and liver at 20 dpc (at protein level). {ECO:0000269|PubMed:21070968}.
Protein families：Nudix hydrolase family, DCP2 subfamily