NOXO1_MOUSE Q8VCM2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VCM2
Recommended name：NADPH oxidase organizer 1
EC number：
Alternative names：(Nox organizer 1) (Sorting nexin-28)
Cleaved into：
GeneID：71893
Gene names (primary )：Noxo1
Gene names (synonym )：Snx28
Gene names (ORF )：
Length：349
Mass：38827
Sequence：MASPRHPVSAHAVALVQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRRSEQVLPKLPDAPLLTRRGHTGRGLVRLRLLDTYVQALLATSEHILRSSALHGFFVPKPLDLEPMLPPGSLVILPTPEEPLSQPRGSLDIHSLEAQSIPCVQPFHTLDIRDRPFHTKAQEILDILLRHPSGWWLVENKDQQVAWFPAPYLEEVATCQGQESGLALQGSGRQFCTTQAYEGSRSDELSVPSGARVHVLETSDRGWWLCRYNGRTGLLPAMSLQPEGLGSLLGRPGFPDSAGADKVAEDRTIPPVVPTRPCMSAIQSRCCSITRRALGQEQGTRVPR
Tissue specificity：Strongly expressed by colon epithelial cells and to a lower extent in small intestine, uterus, stomach and testis. Expressed in different parts of the inner ear including sensory and nonsensory cell layers of the saccule, ampullae of the semicircular canals, the stria vascularis and the spiral glanglion neurons. {ECO:0000269|PubMed:12473664, ECO:0000269|PubMed:15949904, ECO:0000269|PubMed:16431374}.
Induction：
Developmental stage：Strongly expressed in inner ear during embryogenesis. {ECO:0000269|PubMed:16431374}.
Protein families：