LLPH_MOUSE Q9D945
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D945
Recommended name：Protein LLP homolog
EC number：
Alternative names：(Protein LAPS18-like)
Cleaved into：
GeneID：66225
Gene names (primary )：Llph
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：15391
Sequence：MAKSLRSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVEEIATVVVAKPRQEKMQCEEGRCDGADEEKDDMKMETEIKRNRKTLLDQHGQYPVWMNQRQRKRLKAKREKKRGKSRAKAAKGLAW
Tissue specificity：Widely expressed, with high levels in testis and spleen and low levels in heart. In the brain, expressed in the cortex and hippocampus, and at very low levels in the cerebellum. {ECO:0000269|PubMed:26961175}.
Induction：In the hippocampal neurons, down-regulated by sustained activity induced by increased extracellular potassium concentration for a prolonged time (2 - 5 hours) (at protein level). {ECO:0000269|PubMed:26961175}.
Developmental stage：Strongly expressed in the brain in early developmental stages. Expression gradually decreases during development, from very high levels at 13 dpc down to hardly detectable in the adult at day 20 postnatal and later on (at protein level). {ECO:0000269|PubMed:26961175}.
Protein families：Learning-associated protein family