LN28A_MOUSE Q8K3Y3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K3Y3
Recommended name：Protein lin-28 homolog A
EC number：
Alternative names：(Lin-28A) (Testis-expressed protein 17)
Cleaved into：
GeneID：83557
Gene names (primary )：Lin28a
Gene names (synonym )：Lin28 Tex17
Gene names (ORF )：
Length：209
Mass：22720
Sequence：MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQGPSSQGKPAYFREEEEEIHSPALLPEAQN
Tissue specificity：Expressed in embryonic stem cells (ES cells), spermatagonia and testis. Expressed in numerous epithelial tissues including the epithelia of the small intestine, the intralobular duct epithelium of the mammary gland and the epithelia of Henle's loop in the kidney and in the collecting duct (at protein level). Also expressed in the myocardium and skeletal muscle (at protein level). {ECO:0000269|PubMed:11279525, ECO:0000269|PubMed:12798299, ECO:0000269|PubMed:14643679, ECO:0000269|PubMed:15722555}.
Induction：Negatively regulated by the microRNA miR-125b in response to retinoic acid. {ECO:0000269|PubMed:15003116, ECO:0000269|PubMed:16227573}.
Developmental stage：Strongly expressed throughout the whole embryo at 6.5 dpc, including the embryonic and extraembryonic ectoderm and endoderm (at protein level). Subsequently expressed in the ectoderm, endoderm and mesoderm at 7.5 dpc (at protein level). At 9.5 dpc, expressed in epithelia covering the first branchial arch and the coelomic cavity, the myocardium of the developing heart, the neuroepithelium and some extraembryonic tissues such as the visceral yolk sac (at protein level). Expression persists in a variety of epithelial tissues at 10.5 dpc. At 15.5 dpc, expression is lost in bronchial epithelium and becomes weaker in neuroepithelium, while increasing in the myotome of somites, the foregut epithelium, stratified epithelium and some kidney tubules (at protein level). At 17.5 dpc, expression persists in the myocardium and in the epithelium covering the body surface and skeletal muscles (at protein level). Expression is reduced during differentiation of ES cells. In adult primary myoblasts, barely detectable during proliferation, but dramatically up-regulated during terminal differentiation. Induced as early as 24 hours after differentiation signal and remains high as late as 7 days of differentiation. Little expression in resting muscle, but strongly up-regulated during regeneration of skeletal muscle fibers. Expression decreases when regeneration is histologically and functionally complete. {ECO:0000269|PubMed:12798299, ECO:0000269|PubMed:14643679, ECO:0000269|PubMed:15722555, ECO:0000269|PubMed:17473174}.
Protein families：Lin-28 family