ARXS1_MOUSE C0HK79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:C0HK79
Recommended name：Adipocyte-related X-chromosome expressed sequence 1
EC number：
Alternative names：
Cleaved into：
GeneID：76219
Gene names (primary )：Arxes1
Gene names (synonym )：
Gene names (ORF )：
Length：180
Mass：20146
Sequence：MNSLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKILLRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF
Tissue specificity：Strongly expressed in epididymal white and brown adipose tissue with low levels in heart. {ECO:0000269|PubMed:21177646}.
Induction：By the PPARG agonist rosiglitazone. {ECO:0000269|PubMed:21177646}.
Developmental stage：Strongly up-regulated during adipogenesis. {ECO:0000269|PubMed:21177646}.
Protein families：SPCS3 family