CO4A4_MOUSE Q9QZR9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZR9
Recommended name：Collagen alpha-4(IV) chain
EC number：
Alternative names：
Cleaved into：
GeneID：12829
Gene names (primary )：Col4a4
Gene names (synonym )：
Gene names (ORF )：
Length：1682
Mass：164096
Sequence：MRCFFRWTKSFVTAPWSLIFILFTIQYEYGSGKKYGGPCGGRNCSVCQCFPEKGSRGHPGPLGPQGPIGPLGPLGPIGIPGEKGERGDSGSPGPPGEKGDKGPTGVPGFPGVDGVPGHPGPPGPRGKPGVDGYNGSRGDPGYPGERGAPGPGGPPGQPGENGEKGRSVYITGGVKGIQGDRGDPGPPGLPGSRGAQGSPGPMGHAGAPGLAGPIGHPGSPGLKGNPATGLKGQRGEPGEVGQRGPPGPTLLVQPPDLSIYKGEKGVKGMPGMIGPPGPPGRKGAPGVGIKGEKGIPGFPGPRGEPGSHGPPGFPGFKGIQGAAGEPGLFGFLGPKGDLGDRGYPGPPGILLTPAPPLKGVPGDPGPPGYYGEIGDVGLPGPPGPPGRPGETCPGMMGPPGPPGVPGPPGFPGEAGVPGRLDCAPGKPGKPGLPGLPGAPGPEGPPGSDVIYCRPGCPGPMGEKGKVGPPGRRGAKGAKGNKGLCTCPPGPMGPPGPPGPPGRQGSKGDLGLPGWHGEKGDPGQPGAEGPPGPPGRPGAMGPPGHKGEKGDMVISRVKGQKGERGLDGPPGFPGPHGQDGGDGRPGERGDPGPRGDHKDAAPGERGLPGLPGPPGRTGPEGPPGLGFPGPPGQRGLPGEPGRPGTRGFDGTKGQKGDSILCNVSYPGKPGLPGLDGPPGLKGFPGPPGAPGMRCPDGQKGQRGKPGMSGIPGPPGFRGDMGDPGIKGEKGTSPIGPPGPPGSPGKDGQKGIPGDPAFGDPGPPGERGLPGAPGMKGQKGHPGCPGAGGPPGIPGSPGLKGPKGREGSRGFPGIPGSPGHSCERGAPGIPGQPGLPGTPGDPGAPGWKGQPGDMGPSGPAGMKGLPGLPGLPGADGLRGPPGIPGPNGEDGLPGLPGLKGLPGLPGFPGFPGERGKPGPDGEPGRKGEVGEKGWPGLKGDLGERGAKGDRGLPGDAGEAVTSRKGEPGDAGPPGDGGFSGERGDKGSSGMRGGRGDPGRDGLPGLHRGQPGIDGPPGPPGPPGPPGSPGLRGVIGFPGFPGDQGDPGSPGPPGFPGDDGARGPKGYKGDPASQCGPPGPKGEPGSPGYQGRTGVPGEKGFPGDEGPRGPPGRPGQPGSFGPPGCPGDPGMPGLKGHPGEVGDPGPRGDAGDFGRPGPAGVKGPLGSPGLNGLHGLKGEKGTKGASGLLEMGPPGPMGMPGQKGEKGDPGSPGISPPGLPGEKGFPGPPGRPGPPGPAGAPGRAAKGDIPDPGPPGDRGPPGPDGPRGVPGPPGSPGNVDLLKGDPGDCGLPGPPGSRGPPGPPGCQGPPGCDGKDGQKGPMGLPGLPGPPGLPGAPGEKGLPGPPGRKGPVGPPGCRGEPGPPADVDSCPRIPGLPGVPGPRGPEGAMGEPGRRGLPGPGCKGEPGPDGRRGQDGIPGSPGPPGRKGDTGEAGCPGAPGPPGPTGDPGPKGFGPGSLSGFLLVLHSQTDQEPACPVGMPRLWTGYSLLYMEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLSSAAPLPMMPLSEEEIRSYISRCAVCEAPAQAVAVHSQDQSIPPCPRTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFVECQGRQGTCHFFANEYSFWLTTVNPDLQFASGPSPDTLKEVQAQRRKISRCQVCMKHS
Tissue specificity：Expressed in Bruch's membrane, outer plexiform layer, inner nuclear layer, inner plexiform layer, ganglion cell layer, inner limiting membrane and around the blood vessels of the retina (at protein level) (PubMed:29777959). Highly expressed in kidney and lung (PubMed:7962065). Detected at lower levels in heart, muscle and skin (PubMed:7962065). {ECO:0000269|PubMed:29777959, ECO:0000269|PubMed:7962065}.
Induction：
Developmental stage：The expression of collagen IV undergoes a developmental shift in the developing lens capsule. During the early stages of lens capsule development expression of collagens alpha 1(IV), alpha 2(IV), alpha 5(IV) and alpha 6(IV) is observed; this is consistent with the presence of fibrillar alpha 1(IV)-alpha 1(IV)-alpha 2(IV) protomers and of elastic alpha 5(IV)-alpha 5(IV)-alpha 6(IV) protomers. In the later stages of development components of the more cross-linked alpha 3(IV)-alpha 4(IV)-alpha 5(IV) protomer appear. {ECO:0000269|PubMed:12225806}.
Protein families：Type IV collagen family