PHB2_MOUSE O35129
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35129
Recommended name：Prohibitin-2
EC number：
Alternative names：(B-cell receptor-associated protein BAP37) (Repressor of estrogen receptor activity)
Cleaved into：
GeneID：12034
Gene names (primary )：Phb2
Gene names (synonym )：Bap Bcap37 Rea
Gene names (ORF )：
Length：299
Mass：33296
Sequence：MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Tissue specificity：Widely expressed in different tissues. {ECO:0000269|PubMed:11302691, ECO:0000269|PubMed:15140878, ECO:0000269|PubMed:8070406}.
Induction：In B cells, expression is increased by CD40 engagement (at protein level). {ECO:0000269|PubMed:23241883}.
Developmental stage：Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas. {ECO:0000269|PubMed:11302691}.
Protein families：Prohibitin family