GLRX5_MOUSE Q80Y14
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80Y14
Recommended name：Glutaredoxin-related protein 5, mitochondrial
EC number：
Alternative names：(Monothiol glutaredoxin-5)
Cleaved into：
GeneID：73046
Gene names (primary )：Glrx5
Gene names (synonym )：
Gene names (ORF )：
Length：152
Mass：16292
Sequence：MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK
Tissue specificity：Detected in bone, liver, muscle and kidney. {ECO:0000269|PubMed:19442627}.
Induction：
Developmental stage：Ubiquitously expressed at 7.5 dpc. At 8.5 dpc, preferential expression in yolk sac blood islands. Progressive down-regulation in maturing primitive red cells between 10.5 and 12.5 dpc. High expression in fetal liver at 12.5 dpc. {ECO:0000269|PubMed:16110529}.
Protein families：Glutaredoxin family, Monothiol subfamily