SSXT_MOUSE Q62280
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62280
Recommended name：Protein SSXT
EC number：
Alternative names：(Protein SYT) (Synovial sarcoma-associated Ss18-alpha)
Cleaved into：
GeneID：268996
Gene names (primary )：Ss18
Gene names (synonym )：Ssxt Syt
Gene names (ORF )：
Length：418
Mass：45864
Sequence：MSVAFAAPRQRGKGEITPAAIQKMLDENNHLIQCIMDYQNKGKASECSQYQQILHTNLVYLATIADSNQNMQSLLPAPPTQTMPMGPGGMSQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPSQLSMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMNMQPNQGPMMHQQPPSQQYNMPPGGAQHYQGQQAPMGLMGQVNQGSHMMGQRQMPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQSYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ
Tissue specificity：
Induction：
Developmental stage：Ubiquitously expressed in early embryogenesis (12.5 days). In later stages (14.5 days), the expression is restricted to cartilage forming cells, to specific neuronal cells and some epithelial derived tissues. In adults, SSXT is expressed in heart, kidney, testis and also in muscle, brain and liver. In mature testis, expression is specifically observed in primary spermatocytes.
Protein families：SS18 family