ZNF8_MOUSE Q8BGV5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGV5
Recommended name：Zinc finger protein 8
EC number：
Alternative names：(Zinc finger protein 128)
Cleaved into：
GeneID：243833
Gene names (primary )：Znf8
Gene names (synonym )：Zfp128
Gene names (ORF )：
Length：572
Mass：64737
Sequence：MDHQDKAATVAMASRPQATQLQEPVTFRDVAVDFTQEEWGQLDPTQRTLYRDVMLETFGHLLSVGPDLPKPAVISQLEQGAELWVADRGGTGACHPGWILEPEDHTLLKDQGLPKMEPSPITEKDGFAKAVPCRSMIGIDQESDGQRQALKKDQSNLNDPKEIPLQSQSHKSLGLVEACVLGLNTYLLPDISGREYGCTYDSQVKNSEHNPSLVRQRTDSPATQSFDDNGSQKAFDQIMPITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSLVQHERIHTGDKPYKCDECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSVCGKSFSRTTCLFLHLRTHTEERPYECNHCGKGFRHSSSLAQHQRKHAGEKPYECRQRLIFEQAPALIKYEWTEPLGCDSPLSQGERTQRSDRPFKCNQCGKCFTQSSHLIRHQLTHSREEEPLRGRSRRQEQPCRRGSRLIQNTNSNSRELPVAQPKAGQASRTLALFDLREIMQEQNPVHVIGVEEPSVGNSMLFDTRESR
Tissue specificity：Strongly expressed in testis, where it localizes to seminiferous tubules. Weakly expressed in heart, brain, lung, liver and kidney. {ECO:0000269|PubMed:12370310}.
Induction：
Developmental stage：Ubiquitously expressed in embryos. Detected from stage 7 dpc onwards, reaching peak levels at stage 11 dpc and declining by stages 15 dpc and 17 dpc. {ECO:0000269|PubMed:12370310}.
Protein families：Krueppel C2H2-type zinc-finger protein family