PAR11_MOUSE Q8CFF0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CFF0
Recommended name：Protein mono-ADP-ribosyltransferase PARP11
EC number：EC 2.4.2.-
Alternative names：(ADP-ribosyltransferase diphtheria toxin-like 11) (ARTD11) (Poly [ADP-ribose] polymerase 11) (PARP-11)
Cleaved into：
GeneID：101187
Gene names (primary )：Parp11
Gene names (synonym )：
Gene names (ORF )：
Length：331
Mass：38737
Sequence：MFHKTEEFFPKKTDSDVDDMDTSDTQWGWFYLAECGKWHMFQPDTNIQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLVTGKQRLIKRAPFSISAFSYICENEAIPMPTHWENVNPDVPYQLVSLQNQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGVHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Tissue specificity：Predominantly expressed in testis, preferentially in postmeiotic germ cells. Also detectable in other tissues, including liver, lung, spleen, thymus and brain. {ECO:0000269|PubMed:25673562}.
Induction：
Developmental stage：Undetectable in testis until postnatal day 18. Sharply up-regulated from postnatal days 18 to 21. This timeframe corresponds to the appearance of the first spermatids of the first wave of spermatogenesis just before initiation of elongation. Remains elevated in adult animals. {ECO:0000269|PubMed:25673562}.
Protein families：