TLC3B_MOUSE Q7TNV1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TNV1
Recommended name：Ceramide synthase
EC number：EC 2.3.1.-
Alternative names：(Protein FAM57B) (TLC domain-containing protein 3B)
Cleaved into：
GeneID：68952
Gene names (primary )：Tlcd3b
Gene names (synonym )：Fam57b
Gene names (ORF )：
Length：275
Mass：30778
Sequence：MLTPMVAGGVVFPGLFLLSKNTLQRLPQLRWEEADAVIVSARLVSSVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGEDGTPRALGSTWAVVRGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLSVPMAIPAHVNLGAALLLAPQLYWFFLICRGACRLFRPRGSPPPSPCQTQD
Tissue specificity：Each isoform has a distinct expression pattern. Isoform 1 is highly expressed in brain. Isoform 2 is expressed at low levels, if any, in all analyzed tissues, with slightly higher levels in testis. Isoform 3 is expressed at very high levels in testis and, at lower levels, in white adipose tissue. In epididymal fat, isoform 3 is expressed at higher levels in obese mice compared with lean mice. By contrast, isoform 1 and 2 levels are significantly lower in obese mice compared with lean mice. {ECO:0000269|PubMed:23275342}.
Induction：[Isoform 3]: Strongly up-regulated by PPARG.
Developmental stage：Up-regulated during adipogenesis. {ECO:0000269|PubMed:23275342}.
Protein families：