CHRD1_MOUSE Q9D1P4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1P4
Recommended name:Cysteine and histidine-rich domain-containing protein 1
EC number:
Alternative names:(CHORD domain-containing protein 1) (CHORD-containing protein 1) (Chp-1) (Protein morgana)
Cleaved into:
GeneID:66917
Gene names (primary ):Chordc1
Gene names (synonym ):Chp1 Morgana
Gene names (ORF ):
Length:331
Mass:37351
Sequence:MALLCYNRGCGQRFDPEANSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELSELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGSEEDKKEEDSDEIKIGTSCKNGGCSKTYQGLQSLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTRGKHVWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPTTKKQEKQKDIAD
Tissue specificity:Ubiquitously expressed. Highly expressed in spleen, lung and brain (at protein level). Expressed in proliferating myoblasts and its expression remained steady after. Its expression undergoes diurnal and circadian changes in hypothalamus. Highly expressed during the dark-light transition (ZT20.5 (zeitgeber time 20.5) and ZT2.5). {ECO:0000269|PubMed:12965203, ECO:0000269|PubMed:17253150}.
Induction:By Heat shock in a HSF1-dependent manner. {ECO:0000269|PubMed:16083881}.
Developmental stage:Weakly expressed at ZT8.5 and highly expressed at ZT14.5 at P6. At P6 highly expressed at ZT14.5 in hippocampus, prefrontal cortex and cerebellum. First detected and widely distributed at P1 and that continued throughout postnatal development. Expression is evident in the cortical plate (CP) at 17 dpc. Lower levels of expression is also evident in intermediate (IZ) and subventricular (SVZ) zones at this age. A more diffuse expression pattern is evident in early postnatal cortex with only slight differences in intensity throughout cortical layers. By P14, a more laminated distribution pattern becomes evident with a punctate distribution apparent in deep cortical layers. {ECO:0000269|PubMed:17253150}.
Protein families: