NDF4_MOUSE   O09105


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09105

Recommended name:Neurogenic differentiation factor 4

EC number:

Alternative names:(NeuroD4) (Helix-loop-helix protein mATH-3) (mATH3) (Protein atonal homolog 3)

Cleaved into:

GeneID:11923

Gene names  (primary ):Neurod4

Gene names  (synonym ):Ath3 Atoh3

Gene names  (ORF ):

Length:330

Mass:37133

Sequence:MAKMYMKSKDMVELVNTQSWMDKGLSSQNEMKEQERRPGSYGMLGTLTEEHDSIEEDEEEEEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSTLLEKHEEKSSICDSTISVHSFNYQSPGLPSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYNFMPHYTSASLSSGHVHSTPFQTGTPRYDVPVDLSYDSYSHHSIGTQLNTIFSD

Tissue specificity:Expressed in retinal interneurons amacrine cells (at protein level). Expressed in neurons of ventricular zone of the retina at postnatal day 1 (P1). Expressed transiently in amacrine and horizontal cells of the inner nuclear layer (INL) of the retina at P7 until P14. {ECO:0000269|PubMed:11861467, ECO:0000269|PubMed:9029157, ECO:0000269|PubMed:9497361}.

Induction:

Developmental stage:Weakly expressed in the neural tube around 8.5 dpc. By 9.5 dpc, expression is prominent in the ventral brain and spinal cord, and weak expression begins in the retina. At 10.5 dpc, highly expressed in the trigeminal and dorsal root ganglions, and the ventral midbrain and hindbrain. At 12.5 dpc, expressed in the mantle layer of the brain and spinal cord, trigeminal ganglion, Rathke's pouch, dorsal root ganglion and the ventricular zone of the neural retina. At 16.5 dpc, expression becomes restricted to the anterior region, persisting in the diencephalon and neural retina but decreasing in other regions. {ECO:0000269|PubMed:9029157, ECO:0000269|PubMed:9497361}.

Protein families:


   💬 WhatsApp