CL12B_HUMAN   Q2HXU8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q2HXU8

Recommended name:C-type lectin domain family 12 member B

EC number:

Alternative names:(Macrophage antigen H)

Cleaved into:

GeneID:387837

Gene names  (primary ):CLEC12B

Gene names  (synonym ):

Gene names  (ORF ):UNQ5782/PRO16089

Length:276

Mass:31616

Sequence:MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD

Tissue specificity:Detected in colon, heart, kidney, liver, lung, mammary gland, ovary, spleen and testis. {ECO:0000269|PubMed:17562706}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp