SPXN_HUMAN Q9BT56
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BT56
Recommended name：Spexin
EC number：
Alternative names：(NPQ) (Neuropeptide Q) (Spexin hormone)
Cleaved into：Spexin-1; Spexin-2 (NPQ 53-70)
GeneID：80763
Gene names (primary )：SPX
Gene names (synonym )：C12orf39
Gene names (ORF )：
Length：116
Mass：13302
Sequence：MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
Tissue specificity：Expressed in the type I glomic cells within the carotid body (at protein level). Expressed predominantly in pancreas, testis, kidney, brain and placenta. Expressed in submucosal layer of esophagus and stomach fundus. {ECO:0000269|PubMed:17284679, ECO:0000269|PubMed:19132080, ECO:0000269|PubMed:19193193, ECO:0000269|PubMed:23080164}.
Induction：Down-regulated in omental and subcutaneous fat of obese subjects. {ECO:0000269|PubMed:24550067}.
Developmental stage：
Protein families：Spexin family