PLAT2_HUMAN   Q9NWW9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NWW9

Recommended name:Phospholipase A and acyltransferase 2

EC number:EC:2.3.1.-

Alternative names:(HRAS-like suppressor 2)

Cleaved into:

GeneID:54979

Gene names  (primary ):PLAAT2

Gene names  (synonym ):HRASLS2

Gene names  (ORF ):

Length:162

Mass:17394

Sequence:MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQVTGAVTTVGVAAGLLAAASLVGILLARSKRERQ

Tissue specificity:Expressed in liver, kidney, small intestine testis and colon (PubMed:19615464). Undetectable in testis, placenta, salivary gland and fetal brain (PubMed:18163183). {ECO:0000269|PubMed:18163183, ECO:0000269|PubMed:19615464}.

Induction:

Developmental stage:

Protein families:H-rev107 family


   💬 WhatsApp