G45IP_HUMAN Q8TAE8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TAE8
Recommended name：Large ribosomal subunit protein mL64
EC number：
Alternative names：(39S ribosomal protein L59, mitochondrial) (MRP-L59) (CKII beta-associating protein) (CR6-interacting factor 1) (CRIF1) (Growth arrest and DNA damage-inducible proteins-interacting protein 1) (Papillomavirus L2-interacting nuclear protein 1) (PLINP) (PLINP-1) (p53-responsive gene 6 protein)
Cleaved into：
GeneID：90480
Gene names (primary )：GADD45GIP1
Gene names (synonym )：MRPL59 PLINP1 PRG6
Gene names (ORF )：
Length：222
Mass：25384
Sequence：MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Tissue specificity：Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary thyroid cancer. {ECO:0000269|PubMed:12716909}.
Induction：Down-regulated by p53/TP53 in apoptotic cells. {ECO:0000269|PubMed:10441517}.
Developmental stage：
Protein families：Mitochondrion-specific ribosomal protein mL64 family